Skip to content
  • About Us
  • Journals
  • Call for Papers
  • Guidelines
    • Author Guidelines
    • Submission Guidelines
    • Article Processing Charges (APC) Policy
    • Withdrawal Policy
    • ORCID iD Policy
    • Reprints & Permissions
    • Guidelines for Editor-in-Chief and Editorial Board Members
    • Reviewer Guidelines
    • Crossmark Policy
    • Open Access Policy
    • Peer Review Process
  • Ethics and Policies
    • Publication Ethics
    • Editorial Policies
    • Peer Review Policy
    • Archiving & Preservation Policy
    • Preprint Policy
    • Advertisement Policy
    • Copyright & Licensing Policy
    • Publisher Credibility and Transparency Statement
    • Data Availability Policy
  • Submission Instructions
  • Contact
  • About Us
  • Journals
  • Call for Papers
  • Guidelines
    • Author Guidelines
    • Submission Guidelines
    • Article Processing Charges (APC) Policy
    • Withdrawal Policy
    • ORCID iD Policy
    • Guidelines for Editor-in-Chief and Editorial Board Members
    • Reviewer Guidelines
    • Crossmark Policy
    • Open Access Policy
    • Peer Review Process
    • Reprints & Permissions
  • Ethics and Policies
    • Publication Ethics
    • Editorial Policies
    • Peer Review Policy
    • Archiving & Preservation Policy
    • Advertisement Policy
    • Copyright & Licensing Policy
    • Publisher Credibility and Transparency Statement
    • Data Availability Policy
    • Preprint Policy
  • Submission Instructions
  • Contact
  • Submit Manuscript
  • About Us
  • Journals
  • Call for Papers
  • Guidelines
    • Author Guidelines
    • Submission Guidelines
    • Article Processing Charges (APC) Policy
    • Withdrawal Policy
    • ORCID iD Policy
    • Guidelines for Editor-in-Chief and Editorial Board Members
    • Reviewer Guidelines
    • Crossmark Policy
    • Open Access Policy
    • Peer Review Process
    • Reprints & Permissions
  • Ethics and Policies
    • Publication Ethics
    • Editorial Policies
    • Peer Review Policy
    • Archiving & Preservation Policy
    • Advertisement Policy
    • Copyright & Licensing Policy
    • Publisher Credibility and Transparency Statement
    • Data Availability Policy
    • Preprint Policy
  • Submission Instructions
  • Contact
  • Submit Manuscript
Submit manuscript

Other Sea Star Igkappa Gene Cloning Assay in E. Coli with New Parameters

View or Download PDF
Article
Article Info
Figures and Data
Article

Michel Leclerc1*
1Immunology of Invertebrates, Orléans University, France

*Correspondence author: Michel Leclerc, Immunology of Invertebrates, Orléans University, France; Email: mleclerc45@gmail.com

Published Date: 17-06-2023

Copyright© 2023 by Leclerc M. All rights reserved. This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.

Abstract

The plasmid vector pET-28b(+) named “Young” was produced according a work of 2014 (Ref.1). This construct is designed to allow the expression of a 13.6 kDA protein with a C-terminal 6 histag. It is supposed to be an anti-HRP (Horse-Radish Peroxydase protein). This protein was not expressed in first E.coli we attempt to explain this phenomenon.

Keywords: Gene Synthesis; E.coli; Protein; RNA Polymerase; SDS-PAGE

Introduction

In a first time we recall the constuction of our vector with the help of Clinisciences (Paris, France)

The first step was the de novo gene synthesis of the sequence below.

The second step consist of the cloning of the sequence above in pET-28b vector by seamless cloning (Fig. 1). Briefly, Seamless cloning was originally described by Daniel G. Gibson of the J. Craig Venter Institute. The exonuclease-based method is performed under isothermal conditions after linear insert and vector are prepared by PCR and/or restriction digestion [1]. Three enzymatic activities are employed: a 5’ exonuclease generates terminal cohesive ends (overhangs), a polymerase fills in the gaps of the annealed single-stranded regions, and a DNA ligase seals the nicks. We present now the “schema” of our plasmid with the following abbreviations:

position 560-1375: aminoglycoside phosphotransferase – confers resistance to kanamycin or G418

postition 1497-2085: high-copy-number ColE1/pMB1/pBR322/pUC origin of replication

position 2271-2413: basis of mobility region from pBR322

position 2515-2706: Rop protein, which maintains plasmids at low copy number

position 3515-4597: lac repressor

position 4598-4675: lacI promoter

position 4984-5002: promoter for bacteriophage T7 RNA polymerase

position: 5003-5027: lac repressor encoded by lacI binding site

position 5042-5064: efficient ribosome binding site from bacteriophage, T7 gene 10 (Olins and Rangwala, 1989)

position 5071-5430: your gene (M. Leclerc’s gene)

position 5341-5448: 6xHis affinity tag

position 5515-5562: transcription terminator for bacteriophage T7 RNA polymerase the vector is 5587 pb in total.

Figure 1: Details of pET-28b.

In fact, secondly clinisciences with my agreement purposed such a nucleotide sequence and protein one:

Nucleotide Sequence

atgcgtggcaacatggcgtctctatggatgttcttctttgtcgtggggataactttacaacggagtttggcgatttacacgtttcgcgagcaaccgtcggacactagcgcgttgcaggggagcacagtggtgcttcactgctccgttgagcagtacataaacaccacggccatcgtttggtggagccgtgactcggtcatcagccacaacaaagacctgaaactgtccagtctaaacaccgaccagctccaaaggtactcgatttcaggcgacgcatctcggggggaattcaaccttaaaatagtgaactttaccgccacagacgccgccagttaccgctgtcagatgtttgcgctcgagcaccaccaccaccaccactga

Protein Sequence

MRGNMASLWMFFFVVGITLQRSLAIYTFREQPSDTSALQGSTVVLHCSVEQYINTTAIVWWSRDSVISHNKDLKLSSLNTDQLQRYSISGDASRGEFNLKIVNFTATDAASYRCQMFALEHHHHHH

Several colonies from the transformation of BL21 (DE3) (Novagen) with this construct were tested to find the clone allowing the best expression yield. (Collaboration with R D -Biotech (Lyon, France). Several conditions were tested (agitation, inducing concentration and temperature) and resulting fractions from bacterial lysis were analyzed by SDS-PAGE (Fig. 2).

Results

Results are expressed in Fig. 2 with different parameters (agitation, inducing concentration and temperature)

Figure 1: Expression test analysis. SDS-PAGE 15 %, coomassie blue staining A) induction at 37°C 250 rpm with 1 mM IPTG;  induction at 30°C 200 rpm  with 1 mM IPTG and B) induction at 37°C 250 rpm  with 0.5 mM IPTG; induction at 25°C 200 rpm  with 1mM IPTG; C) Western blot analysis anti Histag; EB : total lysate; S : Supernatant obtained after EB centrifugation (soluble fraction); C : Pellet obtained after EB centrifugation (insoluble fraction) ; NI : non induced bacteria; 4 : 4H post- induction; O/N : induction overnight.

Despite several expression tests, it was not possible to demonstrate the expression of the protein of interest. Indeed, the theoretical molecular weight of the protein is 13.6 kDa. No overexpression band is observed at this mass. We observe a band of higher intensity at about 25 kDa, however it is not revealed in WB.

Conclusion

Sequence analysis indicates the presence of a signal sequence. The presence of the signal sequence could have caused the production of the protein in the inclusion body. However, this can hardly explain the lack of expression. The pET28 plasmids are conventionally used in the laboratory and it is very rare to have observe no expression even in western blot. It is possible that this is due to the protein itself or the lack of sequence optimization for the bacterial expression system. So, it seems it was not possible to demonstrate the expression of the protein of interest, may be also we did not use the method of amplification as demonstrated in 2014 with primers [2]. These primers acted at the start of the experimentation.

Conflict of Interest

The author has no conflict of interest to declare.

References

  1. Vincent N, Osteras M, Otten P, Leclerc M. A new gene in A. rubens: A sea star Ig kappa gene. Meta Gene. 2014;2:320-2.
  2. Gibson D, Young L, Chuang RY, Venter JC, Clyde AH, Hamilton OS. Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat Methods. 2009;6:343-5.
Article Info

Article Type

Short Communication

Publication History

Received Date: 17-05-2023 
Accepted Date: 10-06-2023 
Published Date: 17-06-2023

Copyright© 2023 by Leclerc M. All rights reserved. This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.

Citation: Leclerc M. Other Sea Star Igkappa Gene Cloning Assay in E. Coli with New Parameters. J Clin Immunol Microbiol. 2023;4(1):1-4.

Figures and Data

Figure 1: Details of pET-28b.

Figure 1: Expression test analysis. SDS-PAGE 15 %, coomassie blue staining A) induction at 37°C 250 rpm with 1 mM IPTG;  induction at 30°C 200 rpm  with 1 mM IPTG and B) induction at 37°C 250 rpm  with 0.5 mM IPTG; induction at 25°C 200 rpm  with 1mM IPTG; C) Western blot analysis anti Histag; EB : total lysate; S : Supernatant obtained after EB centrifugation (soluble fraction); C : Pellet obtained after EB centrifugation (insoluble fraction) ; NI : non induced bacteria; 4 : 4H post- induction; O/N : induction overnight.

Athenaeum Scientific Publishers is an independent open access scholarly publishing organization in medical, clinical, and health-related scientific disciplines, committed to transparent editorial practices and clearly defined peer review and publication ethics standards.

Important Links

  • Privacy Policy
  • Terms and Conditions
  • License & Copyright
  • Contact Us

Featured Journals

  • Journal of Dermatology Research
  • Journal of Clinical Medical Research
  • Journal of Dental Health and Oral Research
  • Journal of Clinical Immunology & Microbiology
SIGN UP TO OUR NEWSLETTER
Incorrect answer. Please try again.

All open access articles published are distributed under the terms of the Creative Commons Attribution 4.0 International License (CC BY 4.0).

Copyright © 2026 Athenaeum Scientific Publishers. All rights Reserved

Athenaeum Scientific Publishers OPC Pvt. Ltd.


Mohali, Punjab – 140603, India | Email: editorialoffice@athenaeumpub.com